Structure of PDB 6c31 Chain A Binding Site BS02

Receptor Information

>6c31 Chain A (length=195) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAGVTRGAMYHQF
ADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVSG
DPEVRQLILLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQP
VRPLAQVLIGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLN

Ligand information

>6c31 Chain L (length=23) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttaccggcagtctgcttgtaaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6c31 Cytokinin Signaling in Mycobacterium tuberculosis.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	Q8 R11 S12 T15 T47 G49 A50 H53
Binding residue (residue number reindexed from 1)	Q3 R6 S7 T10 T42 G44 A45 H48
Binding affinity	PDBbind-CN: Kd=357nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005886	plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6c31, PDBe:6c31, PDBj:6c31
PDBsum	6c31
PubMed	29921668
UniProt	O53623

[Back to BioLiP]