Structure of PDB 6c1y Chain A Binding Site BS02

Receptor Information
>6c1y Chain A (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAY
FEKVGDTSLDPNDFDFTVTGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c1y Plasticity at the DNA recognition site of the MeCP2 mCG-binding domain.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		K109 R111 S113 G114 R115 S116 D121 Y123
Binding residue
(residue number reindexed from 1)		K18 R20 S22 G23 R24 S25 D30 Y32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c1y, PDBe:6c1y, PDBj:6c1y
PDBsum6c1y
PubMed31356990
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]