Structure of PDB 6c1t Chain A Binding Site BS02

Receptor Information
>6c1t Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYL
GNTVDLSSFDFRTGKMM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c1t Structural basis for the ability of MBD domains to bind methyl-CG and TG sites in DNA.
Resolution1.84 Å
Binding residue
(original residue number in PDB)		R166 K167 S168 G169 L170 D176 K186 R188
Binding residue
(residue number reindexed from 1)		R19 K20 S21 G22 L23 D29 K39 R41
Binding affinityPDBbind-CN: Kd=3.2uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6c1t, PDBe:6c1t, PDBj:6c1t
PDBsum6c1t
PubMed29567833
UniProtQ9UBB5|MBD2_HUMAN Methyl-CpG-binding domain protein 2 (Gene Name=MBD2)

[Back to BioLiP]