Structure of PDB 6bz3 Chain A Binding Site BS02

Receptor Information
>6bz3 Chain A (length=125) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDET
IPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQML
TAAHALAVDAKNLLDVIDQARLKML
Ligand information
>6bz3 Chain D (length=19) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDLSEQMASLEGLMKQLNA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bz3 The binding of DCC-P3 motif and FAK-FAT domain mediates the initial step of netrin-1/DCC signaling for axon attraction.
Resolution2.497 Å
Binding residue
(original residue number in PDB)		Y925 T929 K933 I936 S939 Q943 P946
Binding residue
(residue number reindexed from 1)		Y4 T8 K12 I15 S18 Q22 P25
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bz3, PDBe:6bz3, PDBj:6bz3
PDBsum6bz3
PubMed29479476
UniProtP34152|FAK1_MOUSE Focal adhesion kinase 1 (Gene Name=Ptk2)

[Back to BioLiP]