Structure of PDB 6blw Chain A Binding Site BS02

Receptor Information
>6blw Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMEKRPFMCAYPGCNKRYFKLSHLQRHSRKHTGEKPYQCDFKDCERRFSR
SDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGKSCRWPSCQ
LVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6blw Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution1.835 Å
Binding residue
(original residue number in PDB)		S338 K371 F383 S395 S420
Binding residue
(residue number reindexed from 1)		S22 K55 F67 S79 S98
Binding affinityPDBbind-CN: Kd=10nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6blw, PDBe:6blw, PDBj:6blw
PDBsum6blw
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]