Structure of PDB 6bjv Chain A Binding Site BS02

Receptor Information
>6bjv Chain A (length=148) Species: 39443 (Carnation Italian ringspot virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNS
NQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASR
FLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTP
Ligand information
>6bjv Chain D (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cguacgcggaauacuucgauu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bjv Structural insights into interactions between viral suppressor of RNA silencing protein p19 mutants and small RNAs.
Resolution2.198 Å
Binding residue
(original residue number in PDB)		R18 W19 P37 W42 K60 Q107 V108 G109 S124 G126
Binding residue
(residue number reindexed from 1)		R17 W18 P36 W41 K59 Q106 V107 G108 S123 G125
Binding affinityPDBbind-CN: Kd=0.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0052170 symbiont-mediated suppression of host innate immune response
Cellular Component
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bjv, PDBe:6bjv, PDBj:6bjv
PDBsum6bjv
PubMed31021526
UniProtQ66104|P19_CIRV RNA silencing suppressor p19 (Gene Name=ORF4)

[Back to BioLiP]