Structure of PDB 6b0p Chain A Binding Site BS02

Receptor Information
>6b0p Chain A (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSD
QLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSC
QKKFARSDELVRHHNMHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b0p Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution2.077 Å
Binding residue
(original residue number in PDB)		Y334 H339 Y353 S367 D368 D396 S425 R430
Binding residue
(residue number reindexed from 1)		Y16 H21 Y35 S49 D50 D78 S107 R112
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6b0p, PDBe:6b0p, PDBj:6b0p
PDBsum6b0p
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]