Structure of PDB 6b0o Chain A Binding Site BS02

Receptor Information
>6b0o Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSD
QLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSC
QKKFARSDELVRHHNMHQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6b0o Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites.
Resolution1.552 Å
Binding residue
(original residue number in PDB)		Y353 S367 K371 D396 K399 S425 R430
Binding residue
(residue number reindexed from 1)		Y35 S49 K53 D78 K81 S107 R112
Binding affinityPDBbind-CN: Kd=45nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6b0o, PDBe:6b0o, PDBj:6b0o
PDBsum6b0o
PubMed29294058
UniProtP19544|WT1_HUMAN Wilms tumor protein (Gene Name=WT1)

[Back to BioLiP]