Structure of PDB 6b0b Chain A Binding Site BS02

Receptor Information

>6b0b Chain A (length=180) Species: 9606 (Homo sapiens)

LLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKE
CHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHL
NLRIFASRLYYHWCKPQQDGLRLLCGSQVPVEVMGFPEFADCWENFVDHE
KPLSFNPYKMLEELDKNSRAIKRRLDRIKQ

Ligand information

>6b0b Chain C (length=8)

uuuuuuuu

........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6b0b The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism.
• Resolution: 3.28006 Å
• Binding residue (original residue number in PDB): Y24 R26 W82 W115
• Binding residue (residue number reindexed from 1): Y22 R24 W80 W113

Enzymatic activity

• Enzyme Commision number: 3.5.4.38: single-stranded DNA cytosine deaminase.

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0010526 retrotransposon silencing
• GO:0016554 cytidine to uridine editing
• GO:0044355 clearance of foreign intracellular DNA
• GO:0044828 negative regulation by host of viral genome replication
• GO:0045087 innate immune response
• GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
• GO:0051607 defense response to virus
• GO:0070383 DNA cytosine deamination

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6b0b, PDBe:6b0b, PDBj:6b0b
• PDBsum: 6b0b
• PubMed: 29290613
• UniProt: Q6NTF7|ABC3H_HUMAN DNA dC->dU-editing enzyme APOBEC-3H (Gene Name=APOBEC3H)