Structure of PDB 6amk Chain A Binding Site BS02

Receptor Information

>6amk Chain A (length=52) Species: 54571 (Streptomyces venezuelae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTMGGHRRYREAEVRALM
AG

Ligand information

>6amk Chain Z (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aatgtccgaattacccgaattg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6amk The MerR-like protein BldC binds DNA direct repeats as cooperative multimers to regulate Streptomyces development.
Resolution	3.288 Å
Binding residue (original residue number in PDB)	D24 T27 R30 W31 T42 G44 H46
Binding residue (residue number reindexed from 1)	D16 T19 R22 W23 T34 G36 H38
Binding affinity	PDBbind-CN: Kd=16.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6amk, PDBe:6amk, PDBj:6amk
PDBsum	6amk
PubMed	29556010
UniProt	F2REK9

[Back to BioLiP]