Structure of PDB 6a57 Chain A Binding Site BS02

Receptor Information
>6a57 Chain A (length=131) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKEEEEEEEENEEEECAAYQCNMEGCTMSFSSEKQLMLHKRNICPIKGCG
KNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVHTGAR
PYVCAEPDCGQTFRFVSDFSRHKRKTGHSVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a57 Crystal structures of REF6 and its complex with DNA reveal diverse recognition mechanisms.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
W1311 Y1326 V1340 S1341 S1344 R1348
Binding residue
(residue number reindexed from 1)
W87 Y102 V116 S117 S120 R124
Enzymatic activity
Enzyme Commision number 1.14.11.-
External links
PDB RCSB:6a57, PDBe:6a57, PDBj:6a57
PDBsum6a57
PubMed32257379
UniProtQ9STM3|REF6_ARATH Lysine-specific demethylase REF6 (Gene Name=REF6)

[Back to BioLiP]