Structure of PDB 6a4e Chain A Binding Site BS02

Receptor Information
>6a4e Chain A (length=181) Species: 167879 (Colwellia psychrerythraea 34H) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAGNDSNLIWLDLEMTGLEPVEDVILEIAIIITDSELNILAQGPIFAISQ
TDDVLDNMNPWCIEHHGKSGLTQRCRDSEVSLAHATKESLAFVQEWVPQG
KSPMCGNSIGQDRRFINKYMPDFEDHFHYRNLDVSTIKELAKRWKPEVLE
SVVKTGAHLALDAIKESIAELKVYRELFFKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a4e Structural basis of small RNA hydrolysis by oligoribonuclease (CpsORN) from Colwellia psychrerythraea strain 34H.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		Y129 R130
Binding residue
(residue number reindexed from 1)		Y129 R130
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006259 DNA metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6a4e, PDBe:6a4e, PDBj:6a4e
PDBsum6a4e
PubMed30804410
UniProtQ47VZ4|ORN_COLP3 Oligoribonuclease (Gene Name=orn)

[Back to BioLiP]