Structure of PDB 6a2h Chain A Binding Site BS02

Receptor Information
>6a2h Chain A (length=57) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHK
LPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6a2h Architectural roles of Cren7 in folding crenarchaeal chromatin filament.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		V36 I38 R51 K53
Binding residue
(residue number reindexed from 1)		V33 I35 R48 K50
Binding affinityPDBbind-CN: Kd=0.337uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6a2h, PDBe:6a2h, PDBj:6a2h
PDBsum6a2h
PubMed30499242
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]