Structure of PDB 5zwx Chain A Binding Site BS02

Receptor Information
>5zwx Chain A (length=148) Species: 3726 (Raphanus sativus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIRLPPFLKPGAAVEISSNESGFRGSWYMGKVVAVPSSDSTTTKCEVEYT
TLFFDKEGRKRLREVVDVGQLRPPAPAVSEREKRREVAVGDDVDAFYSDG
WWEGTVTEVMGDGRMSVYFRASKEQIRFRRDELRFHREWVNGAWRPPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zwx Arabidopsis AGDP1 links H3K9me2 to DNA methylation in heterochromatin
Resolution1.9 Å
Binding residue
(original residue number in PDB)
R139 R152 R154
Binding residue
(residue number reindexed from 1)
R114 R127 R129
Enzymatic activity
Enzyme Commision number ?
External links