Structure of PDB 5zux Chain A Binding Site BS02

Receptor Information
>5zux Chain A (length=92) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTTRRRRGTARPGSKAAKLREAAIKTLKRHNAAIKSSELQKEIEKESGLE
IPNMTTFMQSLIKMYPEVKKPYRGQYILEGEIESLEHHHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zux How bacterial xenogeneic silencer rok distinguishes foreign from self DNA in its resident genome.
ResolutionN/A
Binding residue
(original residue number in PDB)		R106 R107 R108 G109 A111 T156 T157 Q160 K171 Y173 R174
Binding residue
(residue number reindexed from 1)		R5 R6 R7 G8 A10 T55 T56 Q59 K70 Y72 R73
Binding affinityPDBbind-CN: Kd=7.9uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5zux, PDBe:5zux, PDBj:5zux
PDBsum5zux
PubMed30252102
UniProtO34857|ROK_BACSU Repressor Rok (Gene Name=rok)

[Back to BioLiP]