Structure of PDB 5zmo Chain A Binding Site BS02

Receptor Information
>5zmo Chain A (length=158) Species: 100226 (Streptomyces coelicolor A3(2)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKTFHRRVGDVRPARRAMGPALHRPVLLLWAIGQAVARAPRLQPWSTTRD
AVAPLMEKYGQVEDGVDGVRYPFWALVRDDLWCVEQAEELTLTSRGRRPT
LESLNAVDPSAGLREDDYNLLRSQPEAAASAAAGLIARYFHLLPAGLLED
FGLHELLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zmo Structural basis for the recognition of sulfur in phosphorothioated DNA.
Resolution1.69 Å
Binding residue
(original residue number in PDB)		A107 R108 T186 S187 R188 R190 R191 T193 L194
Binding residue
(residue number reindexed from 1)		A14 R15 T93 S94 R95 R97 R98 T100 L101
Binding affinityPDBbind-CN: Kd=190nM
Enzymatic activity
Enzyme Commision number ?
External links