Structure of PDB 5zkj Chain A Binding Site BS02

Receptor Information
>5zkj Chain A (length=297) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAEKAVLEQFGFPLTGTEARCYTNHALSYDQAKRVPRWVLEHISKSKIMG
DADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGAMAPAGNNKFSSKAMA
ETFYLSNIVPQDFDNNSGYWNRIEMYCRELTERFEDVWVVSGPLTLPQTR
GDGKKIVSYQVIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEA
IGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQ
EFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zkj A unique exonuclease ExoG cleaves between RNA and DNA in mitochondrial DNA replication.
Resolution2.798 Å
Binding residue
(original residue number in PDB)		K115 S172 L311 R320 R324 K327
Binding residue
(residue number reindexed from 1)		K60 S117 L256 R265 R269 K272
Binding affinityPDBbind-CN: Kd=0.19uM
Enzymatic activity
Catalytic site (original residue number in PDB) C112 A140 N162 N171 E179
Catalytic site (residue number reindexed from 1) C57 A85 N107 N116 E124
Enzyme Commision number 3.1.30.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0016787 hydrolase activity
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:5zkj, PDBe:5zkj, PDBj:5zkj
PDBsum5zkj
PubMed30949702
UniProtQ9Y2C4|EXOG_HUMAN Nuclease EXOG, mitochondrial (Gene Name=EXOG)

[Back to BioLiP]