Structure of PDB 5zfy Chain A Binding Site BS02

Receptor Information
>5zfy Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWF
QNERSRQLRQHRRESPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREE
LARETGLPESRIQIWFQNRRARH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zfy Structural basis for multiple gene regulation by human DUX4.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R20 R23 Y43 R71 R79 R95 R96 R98 T99 R137 W141 N144 R148
Binding residue
(residue number reindexed from 1)		R3 R6 Y26 R54 R62 R69 R70 R72 T73 R111 W115 N118 R122
Binding affinityPDBbind-CN: Kd=68.03nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5zfy, PDBe:5zfy, PDBj:5zfy
PDBsum5zfy
PubMed30322619
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]