Structure of PDB 5z6z Chain A Binding Site BS02

Receptor Information
>5z6z Chain A (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQ
NERSRQLRQHRRESPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREEL
ARETGLPESRIQIWFQNRRARH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z6z Structural basis for multiple gene regulation by human DUX4.
Resolution2.301 Å
Binding residue
(original residue number in PDB)		R20 R23 Y43 Q64 Q68 R71 R95 R96 R98 T99 R137 W141 N144 R148
Binding residue
(residue number reindexed from 1)		R2 R5 Y25 Q46 Q50 R53 R68 R69 R71 T72 R110 W114 N117 R121
Binding affinityPDBbind-CN: Kd=45.24nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5z6z, PDBe:5z6z, PDBj:5z6z
PDBsum5z6z
PubMed30322619
UniProtQ9UBX2|DUX4_HUMAN Double homeobox protein 4 (Gene Name=DUX4)

[Back to BioLiP]