Structure of PDB 5yyf Chain A Binding Site BS02

Receptor Information
>5yyf Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
VVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF
DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yyf Structure-guided development of YEATS domain inhibitors by targeting pi-pi-pi stacking.
Resolution1.903 Å
Binding residue
(original residue number in PDB)		R99 D101
Binding residue
(residue number reindexed from 1)		R99 D101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5yyf, PDBe:5yyf, PDBj:5yyf
PDBsum5yyf
PubMed30374167
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]