Structure of PDB 5ypo Chain A Binding Site BS02

Receptor Information
>5ypo Chain A (length=181) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHF
VSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSA
NAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQ
EFTECFSAIVEGDSFEEIYHKVKRVIEDLSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ypo Synaptic Targeting and Function of SAPAPs Mediated by Phosphorylation-Dependent Binding to PSD-95 MAGUKs.
Resolution2.29 Å
Binding residue
(original residue number in PDB)
C562 P564 R568 R571 Y580 E600 G602 Q603 Y604 Y609 T611 D629 S631
Binding residue
(residue number reindexed from 1)
C30 P32 R36 R39 Y48 E68 G70 Q71 Y72 Y77 T79 D97 S99
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5ypo, PDBe:5ypo, PDBj:5ypo
PDBsum5ypo
PubMed29281827
UniProtP31016|DLG4_RAT Disks large homolog 4 (Gene Name=Dlg4)

[Back to BioLiP]