Structure of PDB 5yiv Chain A Binding Site BS02

Receptor Information
>5yiv Chain A (length=45) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSWTDERVSTLKKLWLDGLSASQIAKQLGGVTRNAVIGKVHRLGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yiv Structural insights into the unique mechanism of transcription activation by Caulobacter crescentus GcrA.
Resolution2.914 Å
Binding residue
(original residue number in PDB)		W3 T32 N34 A35 K39 R42
Binding residue
(residue number reindexed from 1)		W3 T32 N34 A35 K39 R42
Enzymatic activity
Enzyme Commision number ?
External links