Structure of PDB 5yeh Chain A Binding Site BS02

Receptor Information
>5yeh Chain A (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHM
RTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIAR
KSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yeh Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites
Resolution2.328 Å
Binding residue
(original residue number in PDB)
E362 Y392 K395 K423 K449 S450 R457
Binding residue
(residue number reindexed from 1)
E14 Y44 K47 K75 K101 S102 R109
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yeh, PDBe:5yeh, PDBj:5yeh
PDBsum5yeh
PubMed29076501
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]