Structure of PDB 5yeg Chain A Binding Site BS02

Receptor Information
>5yeg Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMR
THSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARK
SDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yeg Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Y358 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 Q418 T421 H425 K429 I446 A447 R448 D451 H455 Q459 R479
Binding residue
(residue number reindexed from 1)		Y9 E13 K16 R19 H20 S23 R28 Y37 R40 K44 R47 H48 Q69 T72 H76 K80 I97 A98 R99 D102 H106 Q110 R130
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yeg, PDBe:5yeg, PDBj:5yeg
PDBsum5yeg
PubMed29076501
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]