Structure of PDB 5yef Chain A Binding Site BS02

Receptor Information
>5yef Chain A (length=169) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRHI
RSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCR
YCDAVFHERYALIQHQKSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5yef Molecular mechanism of directional CTCF recognition of a diverse range of genomic sites
Resolution2.807 Å
Binding residue
(original residue number in PDB)		R339 H340 Y343 K344 K365 R368 H369 S372 R377 Y386 R389 R396 H397 T400 Q418 T421 K429 I446 R448 D451 H455
Binding residue
(residue number reindexed from 1)		R19 H20 Y23 K24 K45 R48 H49 S52 R57 Y66 R69 R76 H77 T80 Q98 T101 K109 I126 R128 D131 H135
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5yef, PDBe:5yef, PDBj:5yef
PDBsum5yef
PubMed29076501
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]