Structure of PDB 5ybd Chain A Binding Site BS02

Receptor Information
>5ybd Chain A (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALLEHHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ybd Comparative structure analysis of the ETSi domain of ERG3 and its complex with the E74 promoter DNA sequence
Resolution2.769 Å
Binding residue
(original residue number in PDB)		Q312 W351 K355 K357 M360 D363 K364 Y371 Y372
Binding residue
(residue number reindexed from 1)		Q2 W41 K45 K47 M50 D53 K54 Y61 Y62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5ybd, PDBe:5ybd, PDBj:5ybd
PDBsum5ybd
PubMed30279318
UniProtP11308|ERG_HUMAN Transcriptional regulator ERG (Gene Name=ERG)

[Back to BioLiP]