Structure of PDB 5y7w Chain A Binding Site BS02

Receptor Information
>5y7w Chain A (length=125) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIFEAQKIEWHEGAHMTGVESFMTKQDTTGKIISIDTSSLRAAGRTGWED
LVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSA
HTKCKLCYPQSPDMQPFIMGIHIID
Ligand information
>5y7w Chain D (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLPPTEQDLKKLFKY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5y7w Targeted Inhibition of the NCOA1/STAT6 Protein-Protein Interaction
Resolution2.25 Å
Binding residue
(original residue number in PDB)		N333 G335
Binding residue
(residue number reindexed from 1)		N93 G95
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0030374 nuclear receptor coactivator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5y7w, PDBe:5y7w, PDBj:5y7w
PDBsum5y7w
PubMed29090910
UniProtP70365|NCOA1_MOUSE Nuclear receptor coactivator 1 (Gene Name=Ncoa1)

[Back to BioLiP]