Structure of PDB 5wvw Chain A Binding Site BS02

Receptor Information
>5wvw Chain A (length=58) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGKKPVKVKTPAGKEAELVPEKVWAAAPKGRKGVKIGLFKDPETGKYFRH
KLPDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wvw Roles of Leu28 side chain intercalation in the interaction between Cren7 and DNA
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R33 K34 I38 R51 H52 K53
Binding residue
(residue number reindexed from 1)		R31 K32 I36 R49 H50 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5wvw, PDBe:5wvw, PDBj:5wvw
PDBsum5wvw
PubMed28377493
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]