Structure of PDB 5w7o Chain A Binding Site BS02

Receptor Information
>5w7o Chain A (length=132) Species: 272558 (Halalkalibacterium halodurans C-125) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFL
AIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKL
VDEAEEWLNTHTYETPILKWQTDKWGEIKADY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w7o 2-Se-T-modified-DNA and native RNA hybrid in complex with RNase H catalytic domain D132N mutant
Resolution1.75 Å
Binding residue
(original residue number in PDB)		N77 P78 T104 N105 N106 K138 W139 S147 T148
Binding residue
(residue number reindexed from 1)		N16 P17 T43 N44 N45 K77 W78 S86 T87
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:5w7o, PDBe:5w7o, PDBj:5w7o
PDBsum5w7o
PubMed
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]