Structure of PDB 5w43 Chain A Binding Site BS02

Receptor Information
>5w43 Chain A (length=202) Species: 511145 (Escherichia coli str. K-12 substr. MG1655) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAH
VLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDL
DIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKIDKRLSPKESE
VLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSS
VT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5w43 Structural Basis for DNA Recognition by the Two-Component Response Regulator RcsB.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		L167 V168 T169 S183 K186 K187
Binding residue
(residue number reindexed from 1)		L160 V161 T162 S176 K179 K180
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001216 DNA-binding transcription activator activity
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0031346 positive regulation of cell projection organization
GO:0043470 regulation of carbohydrate catabolic process
GO:0044011 single-species biofilm formation on inanimate substrate
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0046677 response to antibiotic
GO:1901913 regulation of capsule organization
GO:1902021 regulation of bacterial-type flagellum-dependent cell motility
GO:1990451 cellular stress response to acidic pH
Cellular Component
GO:0005667 transcription regulator complex
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5w43, PDBe:5w43, PDBj:5w43
PDBsum5w43
PubMed29487239
UniProtP0DMC7|RCSB_ECOLI Transcriptional regulatory protein RcsB (Gene Name=rcsB)

[Back to BioLiP]