Structure of PDB 5vvl Chain A Binding Site BS02

Receptor Information
>5vvl Chain A (length=264) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVACIMLEPGTRVSHAAV
RLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLYQAKLALDEDLRLKV
VRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRY
DPWEKGDTINQCISAATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVY
DIADIIKFDTVVPKAFEIARRNPGEPDREVRLACRDIFRSSKTLAKLIPL
IEDVLAAGEIQPPA
Ligand information
>5vvl Chain J (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cactggtggtcgccgcggttggaacactctaagatattaga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vvl Structures of the CRISPR genome integration complex.
Resolution3.31 Å
Binding residue
(original residue number in PDB)		P56 G79 E80 R84 Y86 R163 Y165 D166 W170 S181 T184 S185 Y188 H208 T209 K211 Y217 D244 R245 R248
Binding residue
(residue number reindexed from 1)		P41 G64 E65 R69 Y71 R148 Y150 D151 W153 S164 T167 S168 Y171 H191 T192 K194 Y200 D227 R228 R231
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0004520 DNA endonuclease activity
GO:0005515 protein binding
GO:0008821 crossover junction DNA endonuclease activity
GO:0017108 5'-flap endonuclease activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006974 DNA damage response
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus
GO:0099048 CRISPR-cas system
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vvl, PDBe:5vvl, PDBj:5vvl
PDBsum5vvl
PubMed28729350
UniProtQ46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)

[Back to BioLiP]