Structure of PDB 5vmx Chain A Binding Site BS02

Receptor Information
>5vmx Chain A (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYLSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vmx CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		Y522 A534 E535 T538 R549 Y550 Y562 Q563 S578 G579 Y584 L586 R595 Y597 Y599
Binding residue
(residue number reindexed from 1)		Y42 A54 E55 T58 R69 Y70 Y82 Q83 S98 G99 Y104 L106 R115 Y117 Y119
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vmx, PDBe:5vmx, PDBj:5vmx
PDBsum5vmx
PubMed29546986
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]