Structure of PDB 5vmw Chain A Binding Site BS02

Receptor Information
>5vmw Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vmw CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso.
Resolution2.397 Å
Binding residue
(original residue number in PDB)		R511 Y522 A534 E535 T538 R549 Y550 Y562 S578 Y584 R595 Y597
Binding residue
(residue number reindexed from 1)		R31 Y42 A54 E55 T58 R69 Y70 Y82 S98 Y104 R115 Y117
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vmw, PDBe:5vmw, PDBj:5vmw
PDBsum5vmw
PubMed29546986
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]