Structure of PDB 5vmu Chain A Binding Site BS02

Receptor Information
>5vmu Chain A (length=121) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKV
FPLAEYRTKHEIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGD
SKLYRLHPCRSLQIRQYAYLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vmu CH···O Hydrogen Bonds Mediate Highly Specific Recognition of Methylated CpG Sites by the Zinc Finger Protein Kaiso.
Resolution2.346 Å
Binding residue
(original residue number in PDB)		R511 Y522 E535 T538 R549 Y550 Y562 G579 Y584 L586 R595 Y597 Y599
Binding residue
(residue number reindexed from 1)		R31 Y42 E55 T58 R69 Y70 Y82 G99 Y104 L106 R115 Y117 Y119
Binding affinityPDBbind-CN: Kd=0.2nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5vmu, PDBe:5vmu, PDBj:5vmu
PDBsum5vmu
PubMed29546986
UniProtQ86T24|KAISO_HUMAN Transcriptional regulator Kaiso (Gene Name=ZBTB33)

[Back to BioLiP]