Structure of PDB 5vk1 Chain A Binding Site BS02

Receptor Information
>5vk1 Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDAAAQHMV
YCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vk1 Dithiocarbamate-inspired side chain stapling chemistry for peptide drug design.
Resolution2.69 Å
Binding residue
(original residue number in PDB)
V49 M53 Y99
Binding residue
(residue number reindexed from 1)
V25 M29 Y75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5vk1, PDBe:5vk1, PDBj:5vk1
PDBsum5vk1
PubMed30809370
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]