Structure of PDB 5v0q Chain A Binding Site BS02

Receptor Information

>5v0q Chain A (length=291) Species: 32630 (synthetic construct)

RESINPWILTGFADAEGSFGLYIYNRNRYTTRLRFTITLHNKDKSILENI
QSTWKVGIITNNGDNAVSLHVSRFEDLKVIIDHFEKYPLITQKLGDYKLF
KQAFSVMENKEHLKENGIKELVRIKAKMNWGLTDELKKAFPGNISRERPL
INKNIPNFKWLAGFTSGEGHFGVELIKNSRNSRVHVRLRFEIAQHVRDKN
LMNSLITYLGCGYIYEQNYSERSWLRFSVSKFSDINDKIIPVFQENTLIG
VKLEDFEDWCKVAKLIEEKKHLTESGLDEIKKIKLNMNKGR

Ligand information

>5v0q Chain C (length=26)

ccattgtggatgaatactgccattcc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5v0q Tuning DNA binding affinity and cleavage specificity of an engineered gene-targeting nuclease via surface display, flow cytometry and cellular analyses.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): A21 E22 S24 Y28 Y30 T48 L49 H50 N139 W140 T143 R190 H195 R197 R199 Y223 Y225 Q227 Y229 W234 R236 F242 H281
• Binding residue (residue number reindexed from 1): A15 E16 S18 Y22 Y24 T38 L39 H40 N129 W130 T133 R180 H185 R187 R189 Y213 Y215 Q217 Y219 W224 R226 F232 H271
• Binding affinity: PDBbind-CN: Kd=160nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 15:01:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5v0q', asym_id = 'A', bs = 'BS02', title = 'Tuning DNA binding affinity and cleavage specifi...e display, flow cytometry and cellular analyses. '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5v0q', asym_id='A', bs='BS02', title='Tuning DNA binding affinity and cleavage specifi...e display, flow cytometry and cellular analyses. ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '5v0q', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='5v0q', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>