Structure of PDB 5und Chain A Binding Site BS02

Receptor Information

>5und Chain A (length=171) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRH
MRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIA
RKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERYALIQHQKSHKNEKRFKC
DQCDYACRQERHMIMHKRTHT

Ligand information

>5und Chain D (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gtgcccacagaggccagcagggggcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5und Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution	2.549 Å
Binding residue (original residue number in PDB)	Y358 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 T400 Q418 H425 K429 A447 R448 D451 H455 Q459 R479 Y502 Q506
Binding residue (residue number reindexed from 1)	Y11 E15 K18 R21 H22 S25 R30 Y39 R42 K46 R49 H50 T53 Q71 H78 K82 A100 R101 D104 H108 Q112 R132 Y155 Q159

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:5und, PDBe:5und, PDBj:5und
PDBsum	5und
PubMed	28529057
UniProt	P49711\|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]