Structure of PDB 5ud5 Chain A Binding Site BS02

Receptor Information
>5ud5 Chain A (length=86) Species: 192952 (Methanosarcina mazei Go1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNN
SRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKA
Ligand information
>5ud5 Chain D (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggaaaccugaucauguagaucgaauggacucuaaauccguucagccgggu
uagauucccgggguuuccgcca
<<<<<<<.<<<<.....>>>><<<<<<<.......>>>>>>>..<<<<<.
......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ud5 Crystal structures reveal an elusive functional domain of pyrrolysyl-tRNA synthetase.
Resolution2.347 Å
Binding residue
(original residue number in PDB)
K4 P5 T8 V31 S32 R33 R52
Binding residue
(residue number reindexed from 1)
K4 P5 T8 V31 S32 R33 R52
Enzymatic activity
Enzyme Commision number 6.1.1.26: pyrrolysine--tRNA(Pyl) ligase.
Gene Ontology
Molecular Function
GO:0004812 aminoacyl-tRNA ligase activity

View graph for
Molecular Function
External links
PDB RCSB:5ud5, PDBe:5ud5, PDBj:5ud5
PDBsum5ud5
PubMed29035363
UniProtQ8PWY1|PYLS_METMA Pyrrolysine--tRNA ligase (Gene Name=pylS)

[Back to BioLiP]