Structure of PDB 5t30 Chain A Binding Site BS02

Receptor Information
>5t30 Chain A (length=199) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEAL
AKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKR
DFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGT
TGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Ligand information
Ligand IDAZI
InChIInChI=1S/N3/c1-3-2/q-1
InChIKeyIVRMZWNICZWHMI-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
CACTVS 3.341
OpenEye OEToolkits 1.5.0		[N-]=[N+]=[N-]
FormulaN3
NameAZIDE ION
ChEMBLCHEMBL79455
DrugBank
ZINC
PDB chain5t30 Chain A Residue 205 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t30 Substrate-analog binding and electrostatic surfaces of human manganese superoxide dismutase.
Resolution1.77 Å
Binding residue
(original residue number in PDB)		H26 H30 H31 Y34 H74 H163
Binding residue
(residue number reindexed from 1)		H27 H31 H32 Y35 H75 H164
Annotation score1
Enzymatic activity
Enzyme Commision number 1.15.1.1: superoxide dismutase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004784 superoxide dismutase activity
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0019899 enzyme binding
GO:0030145 manganese ion binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000302 response to reactive oxygen species
GO:0000303 response to superoxide
GO:0001666 response to hypoxia
GO:0001836 release of cytochrome c from mitochondria
GO:0001889 liver development
GO:0003032 detection of oxygen
GO:0003069 acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006749 glutathione metabolic process
GO:0006801 superoxide metabolic process
GO:0006979 response to oxidative stress
GO:0007005 mitochondrion organization
GO:0007507 heart development
GO:0007626 locomotory behavior
GO:0008217 regulation of blood pressure
GO:0008285 negative regulation of cell population proliferation
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
GO:0008631 intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0008637 apoptotic mitochondrial changes
GO:0009410 response to xenobiotic stimulus
GO:0009791 post-embryonic development
GO:0010042 response to manganese ion
GO:0010043 response to zinc ion
GO:0010269 response to selenium ion
GO:0010332 response to gamma radiation
GO:0010729 positive regulation of hydrogen peroxide biosynthetic process
GO:0014823 response to activity
GO:0019430 removal of superoxide radicals
GO:0022904 respiratory electron transport chain
GO:0030097 hemopoiesis
GO:0030335 positive regulation of cell migration
GO:0031667 response to nutrient levels
GO:0032364 intracellular oxygen homeostasis
GO:0032496 response to lipopolysaccharide
GO:0033591 response to L-ascorbic acid
GO:0034021 response to silicon dioxide
GO:0034599 cellular response to oxidative stress
GO:0035900 response to isolation stress
GO:0035902 response to immobilization stress
GO:0042311 vasodilation
GO:0042542 response to hydrogen peroxide
GO:0042554 superoxide anion generation
GO:0042743 hydrogen peroxide metabolic process
GO:0043066 negative regulation of apoptotic process
GO:0043524 negative regulation of neuron apoptotic process
GO:0045429 positive regulation of nitric oxide biosynthetic process
GO:0045599 negative regulation of fat cell differentiation
GO:0046686 response to cadmium ion
GO:0048147 negative regulation of fibroblast proliferation
GO:0048666 neuron development
GO:0048678 response to axon injury
GO:0048773 erythrophore differentiation
GO:0050665 hydrogen peroxide biosynthetic process
GO:0051289 protein homotetramerization
GO:0051602 response to electrical stimulus
GO:0051881 regulation of mitochondrial membrane potential
GO:0055093 response to hyperoxia
GO:0060586 multicellular organismal-level iron ion homeostasis
GO:0071000 response to magnetism
GO:0071361 cellular response to ethanol
GO:0072593 reactive oxygen species metabolic process
GO:1902176 negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1902631 negative regulation of membrane hyperpolarization
GO:1904706 negative regulation of vascular associated smooth muscle cell proliferation
GO:1905461 positive regulation of vascular associated smooth muscle cell apoptotic process
GO:1905932 positive regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0042645 mitochondrial nucleoid
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t30, PDBe:5t30, PDBj:5t30
PDBsum5t30
PubMed28461152
UniProtP04179|SODM_HUMAN Superoxide dismutase [Mn], mitochondrial (Gene Name=SOD2)

[Back to BioLiP]