Structure of PDB 5t2h Chain A Binding Site BS02

Receptor Information

>5t2h Chain A (length=296) Species: 32630 (synthetic construct)

SSINPWILTGFADAEGSFILDIRNRNNESNRYRTSLRFQITLHNKDKSIL
ENIQSTWKVGKITNSSDRAVMLRVTRFEDLKVIIDHFEKYPLITQKLGDY
KLFKQAFSVMENKEHLKENGIKELVRIKAKMNWGLNDELKKAFPENISKE
RPLINKNIPNFKWLAGFTAGEGHFGVNLKKVKGTAKVYVGLRFAISQHIR
DKNLMNSLITYLGCGSIREKNKSEFRWLEFEVTKFSDINDKIIPVFQENT
LIGVKLEDFEDWCKVAKLIEEKKHLTESGLDEIKKIKLNMNKGRVF

Ligand information

>5t2h Chain C (length=25)

caaaatcggtgaataggcagacacc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5t2h Crystallographic analyses illustrate significant plasticity and efficient recoding of meganuclease target specificity.
• Resolution: 2.517 Å
• Binding residue (original residue number in PDB): A21 E22 S24 I26 R30 R40 Q46 T48 L49 H50 R75 K103 N139 W140 Y195 R225 K227 K229 W234 E238 K241 F242 H281
• Binding residue (residue number reindexed from 1): A14 E15 S17 I19 R23 R33 Q39 T41 L42 H43 R68 K96 N132 W133 Y188 R218 K220 K222 W227 E231 K234 F235 H274

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 06:36:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5t2h', asym_id = 'A', bs = 'BS02', title = 'Crystallographic analyses illustrate significant...ient recoding of meganuclease target specificity.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5t2h', asym_id='A', bs='BS02', title='Crystallographic analyses illustrate significant...ient recoding of meganuclease target specificity.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '5t2h', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='5t2h', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>