Structure of PDB 5t0u Chain A Binding Site BS02

Receptor Information
>5t0u Chain A (length=170) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THKCHLCGRAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRR
YKHTHEKPFKCSMCDYASVEVSKLKRHIRSHTGERPFQCSLCSYASRDTY
KLKRHMRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHC
DTVIARKSDLGVHLRKQHSY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t0u Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution3.199 Å
Binding residue
(original residue number in PDB)		R301 F303 H312 T315 F331 E336 R339 H340 Y343 K344 Y358 E362 K365 R368 H369 R377 R389 K393 R396 H397 K405 F416 Q418 T421 H425 K429 R448 D451
Binding residue
(residue number reindexed from 1)		R9 F11 H20 T23 F39 E44 R47 H48 Y51 K52 Y66 E70 K73 R76 H77 R85 R97 K101 R104 H105 K113 F124 Q126 T129 H133 K137 R156 D159
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5t0u, PDBe:5t0u, PDBj:5t0u
PDBsum5t0u
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]