Structure of PDB 5t00 Chain A Binding Site BS02

Receptor Information
>5t00 Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYASVEVSKLKRH
IRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQS
GTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5t00 Structural Basis for the Versatile and Methylation-Dependent Binding of CTCF to DNA.
Resolution2.19 Å
Binding residue
(original residue number in PDB)		F331 R339 H340 Y343 K344 Y358 E362 K365 R368 H369 S372 R377 Y386 R389 K393 R396 H397 T400 K405 F416 T417 Q418 T421 H425 K429 I446 R448 D451
Binding residue
(residue number reindexed from 1)		F12 R20 H21 Y24 K25 Y39 E43 K46 R49 H50 S53 R58 Y67 R70 K74 R77 H78 T81 K86 F97 T98 Q99 T102 H106 K110 I127 R129 D132
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5t00, PDBe:5t00, PDBj:5t00
PDBsum5t00
PubMed28529057
UniProtP49711|CTCF_HUMAN Transcriptional repressor CTCF (Gene Name=CTCF)

[Back to BioLiP]