Structure of PDB 5sy7 Chain A Binding Site BS02

Receptor Information

>5sy7 Chain A (length=276) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSH
MKSLPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQ
SEWFGSTLYDQVHPDDVDKLREQLSTSSRRSFICRMRCGTNGLGSVKEGE
PHFVVVHCTGYLVAIGRLQVTSSPEFISRHNIEGIFTFVDHRCVATVGYQ
PQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKTREWL
WMRTSSFTFQNPYSDEIEYIICTNTN

Ligand information

>5sy7 Chain D (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cacgacccgcacgtacgcagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5sy7 NPAS1-ARNT and NPAS3-ARNT crystal structures implicate the bHLH-PAS family as multi-ligand binding transcription factors.
Resolution	4.2 Å
Binding residue (original residue number in PDB)	H94 E98 R101
Binding residue (residue number reindexed from 1)	H6 E10 R13
Binding affinity	PDBbind-CN: Kd=17.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus
GO:0005667	transcription regulator complex
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5sy7, PDBe:5sy7, PDBj:5sy7
PDBsum	5sy7
PubMed	27782878
UniProt	P53762\|ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator (Gene Name=Arnt)

[Back to BioLiP]