Structure of PDB 5odg Chain A Binding Site BS02

Receptor Information
>5odg Chain A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQN
VNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELC
EFAFNMKKDEVCVNPYHYQRVETPVL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5odg Structural basis for genome wide recognition of 5-bp GC motifs by SMAD transcription factors.
Resolution2.12 Å
Binding residue
(original residue number in PDB)		R74 H101
Binding residue
(residue number reindexed from 1)		R65 H92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005667 transcription regulator complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5odg, PDBe:5odg, PDBj:5odg
PDBsum5odg
PubMed29234012
UniProtP84022|SMAD3_HUMAN Mothers against decapentaplegic homolog 3 (Gene Name=SMAD3)

[Back to BioLiP]