Structure of PDB 5oc6 Chain A Binding Site BS02

Receptor Information
>5oc6 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFS
SIVTVAEQKYQSTLWDKSKKLAEQAAAIVCLRSQGLPEGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5oc6 Molecular basis for transfer RNA recognition by the double-stranded RNA-binding domain of human dihydrouridine synthase 2.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q367 T369 K371 M372 L375 K420 Q424
Binding residue
(residue number reindexed from 1)		Q17 T19 K21 M22 L25 K70 Q74
Enzymatic activity
Enzyme Commision number 1.3.1.91: tRNA-dihydrouridine(20) synthase [NAD(P)(+)].
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:5oc6, PDBe:5oc6, PDBj:5oc6
PDBsum5oc6
PubMed30605527
UniProtQ9NX74|DUS2L_HUMAN tRNA-dihydrouridine(20) synthase [NAD(P)+]-like (Gene Name=DUS2)

[Back to BioLiP]