Structure of PDB 5ob2 Chain A Binding Site BS02

Receptor Information
>5ob2 Chain A (length=56) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFVALYDYESRTTTDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPS
NYVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ob2 Crystal structure of the c-Src-SH3 domain E97T mutant in complex with the high affinity peptide APP12
Resolution1.8 Å
Binding residue
(original residue number in PDB)
L89 Y90 K104
Binding residue
(residue number reindexed from 1)
L5 Y6 K20
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:5ob2, PDBe:5ob2, PDBj:5ob2
PDBsum5ob2
PubMed
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]