Structure of PDB 5o17 Chain A Binding Site BS02

Receptor Information

>5o17 Chain A (length=148) Species: 10090 (Mus musculus)

RPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSP
EDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVR
LSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDG

Ligand information

• Ligand ID: KR
• InChI: InChI=1S/Kr
• InChIKey: DNNSSWSSYDEUBZ-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  CACTVS 3.341
  OpenEye OEToolkits 1.5.0: [Kr]
• Formula: Kr
• Name: KRYPTON
• ChEMBL: CHEMBL1233877
• PDB chain: 5o17 Chain A Residue 204

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5o17 Mapping Hydrophobic Tunnels and Cavities in Neuroglobin with Noble Gas under Pressure.
• Resolution: 1.8 Å
• Binding residue (original residue number in PDB): F28 A29 F32 L56
• Binding residue (residue number reindexed from 1): F26 A27 F30 L54
• Annotation score: 1

Enzymatic activity

• Enzyme Commision number: 1.7.-.-

Gene Ontology

Molecular Function

• GO:0005092 GDP-dissociation inhibitor activity
• GO:0005344 oxygen carrier activity
• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0098809 nitrite reductase activity

Biological Process

• GO:0015671 oxygen transport
• GO:0071456 cellular response to hypoxia

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005829 cytosol

External links

• PDB: RCSB:5o17, PDBe:5o17, PDBj:5o17
• PDBsum: 5o17
• PubMed: 29108649
• UniProt: Q9ER97|NGB_MOUSE Neuroglobin (Gene Name=Ngb)