Structure of PDB 5ns3 Chain A Binding Site BS02

Receptor Information
>5ns3 Chain A (length=135) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLILEKAAQELAL
ITGQKPAVTRAPIGLRVTLRRDRMWIFLEKLLNVALPRIRGLNPNSFDGR
GNYNLGLGMDIAVVTTAETDEEARALLELLGFPFR
Ligand information
>5ns3 Chain D (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgcaccugacccaugccgaacucagagugcg
.<<<<<<<<<............>>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ns3 Crystal Structures of Cyanine Fluorophores Stacked onto the End of Double-Stranded RNA.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Q66 K67 A69 R91 V92 T93 R95 R96 R98
Binding residue
(residue number reindexed from 1)		Q54 K55 A57 R66 V67 T68 R70 R71 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ns3, PDBe:5ns3, PDBj:5ns3
PDBsum5ns3
PubMed29211987
UniProtP41201|RL5_THETH Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]