Structure of PDB 5nnx Chain A Binding Site BS02

Receptor Information
>5nnx Chain A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLR
TGKTRTRKQVSSHIQVLARRKSRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nnx TEAD1 bound to DNA
Resolution3.29 Å
Binding residue
(original residue number in PDB)		G68 R69 N70 E71 R87 Q95
Binding residue
(residue number reindexed from 1)		G38 R39 N40 E41 R57 Q65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5nnx, PDBe:5nnx, PDBj:5nnx
PDBsum5nnx
PubMed
UniProtP28347|TEAD1_HUMAN Transcriptional enhancer factor TEF-1 (Gene Name=TEAD1)

[Back to BioLiP]