Structure of PDB 5nc7 Chain A Binding Site BS02

Receptor Information
>5nc7 Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRK
IQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFAS
AMMHALEVL
Ligand information
>5nc7 Chain J (length=10) Species: 1639 (Listeria monocytogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WPPPPTEDEL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nc7 Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y16 D18
Binding residue
(residue number reindexed from 1)		Y14 D16
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5nc7, PDBe:5nc7, PDBj:5nc7
PDBsum5nc7
PubMed33184177
UniProtQ8N8S7|ENAH_HUMAN Protein enabled homolog (Gene Name=ENAH)

[Back to BioLiP]